Tirzepatide
From CAD $50 CAD $256
Contents: Tirzepatide (Dual GIP and GLP-1 Receptor Agonist)
Form: Powder
Purity: 99.3%
TESTED FOR:
- PURITY
- STERILITY
- WEIGHT
- ENDOTOXINS(LPS)
Free Reconstitution solution automatically added to your cart with each order of vial.
This product is Made, Tested & Shipped From Canada.
Ships Today
Order by 1:00 PM EST
Free Shipping
For 2 or more vials
99%+ Purity Guaranteed
COA Verified+
Trackable Shipping
Tirzepatide Peptide
Tirzepatide is a synthetic 39-amino-acid peptide that functions as a dual agonist of the glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors. It is designed to mimic the actions of endogenous incretin hormones, which play a key role in glucose metabolism, energy balance, and appetite regulation. Tirzepatide is being investigated in metabolic and endocrine research as a next-generation incretin-based compound for glycemic control and body-weight modulation.
Overview
Tirzepatide combines GIP and GLP-1 receptor activity within a single molecule, producing additive or synergistic effects on insulin secretion, glucagon suppression, and satiety regulation. Its design includes a C20 fatty diacid moiety attached via a linker at Lys20, allowing reversible albumin binding and prolonged circulation time.
In preclinical and clinical research, Tirzepatide has demonstrated dose-dependent reductions in blood glucose and body weight, along with favorable effects on lipid metabolism and insulin sensitivity. It is of interest for studies exploring integrated incretin signaling, metabolic efficiency, and energy homeostasis.
Chemical Makeup
- Molecular Formula: C225H348N48O68
- Molecular Weight: 4813.5 g/mol
- Amino Acid Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (modified GIP/GLP-1 hybrid sequence with C20 fatty diacid side chain at Lys20)
- Compound Class: Dual GIP/GLP-1 receptor agonist
- Form: Lyophilized peptide
- Purity: ≥99% (per COA)
- Sizes Available: 5mg, 10mg, 15mg, 20mg, 30mg vials
Research and Clinical Studies
Glucose Homeostasis
Tirzepatide enhances glucose-dependent insulin secretion while suppressing glucagon release, resulting in improved glycemic profiles. Animal and human studies have shown significant HbA1c reduction compared with selective GLP-1 agonists.
Body-Weight Regulation
Research demonstrates that Tirzepatide influences hypothalamic appetite pathways through dual incretin receptor signaling, leading to reduced energy intake and body-weight loss in preclinical and clinical models.
Insulin Sensitivity and Lipid Metabolism
Tirzepatide has been shown to increase insulin sensitivity in hepatic and peripheral tissues, reduce plasma triglycerides, and improve overall lipid handling in metabolic disease models.
Cardiometabolic and Hepatic Function
Studies indicate that dual incretin activation may reduce systemic inflammation, improve endothelial function, and support hepatic lipid clearance, suggesting cardioprotective and hepatoprotective potential.
Mechanism and Pharmacokinetics
The albumin-binding C20 acyl chain provides an extended elimination half-life (~5 days in primate models), supporting once-weekly administration in long-term metabolic research protocols.
Tirzepatide peptide is available for research and laboratory purposes only. Not for human consumption.
References
- Frias JP, et al. Tirzepatide versus semaglutide in type 2 diabetes. N Engl J Med. 2021;385(6):503–515. https://pubmed.ncbi.nlm.nih.gov/34170647/
- Coskun T, et al. LY3298176, a novel dual GIP and GLP-1 receptor agonist for the treatment of type 2 diabetes. Sci Transl Med. 2018;10(467):eaao6119. https://pubmed.ncbi.nlm.nih.gov/30404864/
- Willard FS, et al. Tirzepatide: discovery and preclinical profile. Cell Metab. 2020;31(3):564–574.e5. https://pubmed.ncbi.nlm.nih.gov/32084394/
- Heise T, et al. Pharmacokinetics and pharmacodynamics of the dual GIP/GLP-1 receptor agonist Tirzepatide. Clin Pharmacokinet. 2022;61(3):359–372. https://pubmed.ncbi.nlm.nih.gov/34694692/
- Drucker DJ. Mechanisms of incretin hormone action. Cell Metab. 2018;27(4):740–756. https://pubmed.ncbi.nlm.nih.gov/29551581/
- Thomas MK, et al. Dual incretin receptor agonists in metabolic research. Diabetes Obes Metab. 2020;22(12):2368–2378. https://pubmed.ncbi.nlm.nih.gov/32706522/
- Heise T, et al. Safety, tolerability, and pharmacology of Tirzepatide in humans. Diabetes Care. 2020;43(12):2910–2918. https://pubmed.ncbi.nlm.nih.gov/32978147/
- Samms RJ, et al. Effects of dual GIP/GLP-1 receptor agonism on energy metabolism. Nat Metab. 2020;2(6):556–563. https://pubmed.ncbi.nlm.nih.gov/32694636/
- Urva SR, et al. Pharmacokinetic and pharmacodynamic modeling of Tirzepatide. Diabetes Obes Metab. 2021;23(1):220–227. https://pubmed.ncbi.nlm.nih.gov/32862523/
- Nauck MA, et al. Incretin therapies and metabolic disease mechanisms. Diabetologia. 2021;64(9):1971–1985. https://pubmed.ncbi.nlm.nih.gov/34050724/
HIGHEST QUALITY PEPTIDES
Our products are scientifically formulated and manufactured in cGMP-compliant facilities.
FAST DELIVERY
Enjoy fast and reliable 3–5 day shipping.
Dedicated Customer Service
Our customer service team is highly knowledgeable in peptide research and its applications. We’re available 24/7 to assist you.
Tested. Verified. Trusted.
We take a laboratory-first approach to quality. Each batch is made under controlled conditions and verified by an independent lab (HPLC/MS). We only ship batches that test ≥99% purity, and we provide a full COA, including identity, methods, and chromatograms, for your review.
See the Process for Yourself
We make our peptides in our own cGMP lab. Watch the video to see how every vial is produced, tested, and handled with care.
Science Behind Our Peptides
A clear explanation of how our peptides work, their benefits, why quality matters for best results, and what you should know.
Categories
Categories
How do I know the peptides I order are exactly what the label says?
Every vial we sell comes from a lab that follows current Good Manufacturing Practices (cGMP). That means each step of production is documented and controlled. Before a batch is released, it’s tested by independent third-party labs for purity, identity, and sterility. Certificates of analysis are available so you can see the exact test results.
Are your peptides produced in a sterile and controlled environment?
Yes. The labs we work with use ISO-certified clean rooms where air quality, equipment, and handling procedures are tightly regulated. Staff are trained to pharmaceutical-grade standards. This ensures the peptides are produced in an environment that minimizes contamination risks.
What about shipping? Do the peptides remain stable in transit?
Peptides in lyophilized (freeze-dried) form are stable at room temperature for transport. Once you receive them, refrigeration is recommended to maintain long-term integrity. We package every order securely to prevent damage and ship promptly, so your vials arrive in optimal condition.
How do I know you actually make these peptides yourselves?
We operate under strict in-house protocols that follow current Good Manufacturing Practices (cGMP). That means our team oversees the entire process from sourcing raw amino acids to the final lyophilized vial. Nothing is outsourced or repackaged. This gives us full control over purity, consistency, and sterility, and it’s why we can stand behind every single vial we ship.
What should I do with the vials once they arrive?
Store them in the refrigerator, away from direct light and heat. If you need to keep them longer, some peptides can be stored frozen. Each vial comes with clear handling instructions so you know the proper conditions for stability.
What proof do you have that your peptides are legitimate?
The strongest proof is transparency. For every peptide, we can provide certificates of analysis, manufacturing documentation, and references to the published scientific research behind it. If you ever have questions, we’ll show you the data rather than ask you to take our word for it.