BPC-157 + TB-500 + GHK-Cu
From CAD $139 CAD $155
TESTED FOR:
- PURITY
- STERILITY
- WEIGHT
- ENDOTOXINS(LPS)
Free Reconstitution solution automatically added to your cart with each order of vial.
This product is Made, Tested & Shipped From Canada.
Ships Today
Order by 1:00 PM EST
Free Shipping
For 2 or more vials
99%+ Purity Guaranteed
COA Verified+
Trackable Shipping
BPC/TB/GHK Peptide Blend – 70mg
This advanced peptide blend combines three well-studied research peptides: BPC-157 (Body Protection Compound 157), TB-500 (a synthetic fragment of thymosin beta-4), and GHK-Cu (glycyl-L-histidyl-L-lysine copper complex). Each component has been evaluated independently for its role in tissue regeneration, angiogenesis, and cellular repair. This combination offers a versatile research tool to investigate synergistic effects in wound healing, musculoskeletal regeneration, and skin remodeling models.
Overview
- BPC-157 (20mg): A stable gastric-derived pentadecapeptide studied for its ability to promote angiogenesis, collagen deposition, and repair in tendon, ligament, muscle, and gastrointestinal tissues.
- TB-500 (40mg): A 43-amino-acid synthetic analogue of thymosin beta-4’s active domain, investigated for cell migration, wound healing, and vascular remodeling.
- GHK-Cu (10mg): A naturally occurring copper-binding tripeptide studied for stimulating collagen synthesis, modulating inflammation, and supporting skin and hair health in aging models.
Research indicates these peptides may act synergistically, supporting angiogenesis, fibroblast activity, and extracellular matrix formation. Their combination has been used to explore regenerative and anti-aging pathways, neuroprotection, and connective tissue biology in preclinical systems.
Chemical Makeup
- BPC-157: C62H98N16O22 | MW: 1419.5 g/mol | Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
- TB-500: C212H350N56O78S | MW: 4963 g/mol | Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- GHK-Cu: C14H24CuN6O4 | MW: 340.9 g/mol (without Cu: 340.4) | Sequence: Gly-His-Lys (copper complex)
- Blend Total: 70mg per vial (BPC-157 20mg, TB-500 40mg, GHK-Cu 10mg)
Research and Clinical Studies
Soft Tissue and Musculoskeletal Models
- BPC-157 has been shown to stimulate fibroblast migration, tendon-to-bone healing, and angiogenesis.
- TB-500 research indicates enhanced actin polymerization and endothelial cell migration, critical for tissue regeneration.
- The combination of these peptides has been studied in muscle and joint injury models for accelerated recovery and improved structural integrity.
Neuroprotection and Vascular Support
- TB-500 has demonstrated neuroprotective activity in brain and spinal cord injury models, supporting vascularization and remyelination.
- GHK-Cu is known for restoring microcirculation and supporting neuronal repair pathways, suggesting combined benefit for neurovascular studies.
Skin and Hair Research
- GHK-Cu has been widely studied for skin remodeling, collagen synthesis, and hair follicle stimulation, showing potential anti-aging properties in preclinical and cosmetic research models.
- When combined with regenerative peptides like BPC-157 and TB-500, it offers a multi-targeted approach to tissue restoration.
Inflammation and Oxidative Stress Modulation
- All three peptides have shown activity in reducing pro-inflammatory cytokine production, stabilizing oxidative stress markers, and supporting mitochondrial function in various experimental systems.
BPC/TB/GHK peptide blend is available for research and laboratory purposes only. Not for human consumption.
References
- Sikiric P, et al. Stable gastric pentadecapeptide BPC 157: tissue healing and angiogenesis. Front Pharmacol. 2021;12:627533. https://doi.org/10.3389/fphar.2021.627533
- Chang CH, et al. Pentadecapeptide BPC-157 enhances tendon healing. J Appl Physiol. 2011;110(3):774–780. https://pubmed.ncbi.nlm.nih.gov/21030672/
- Malinda KM, et al. Thymosin β4 accelerates wound healing. J Invest Dermatol. 1999;113(3):364–368. https://pubmed.ncbi.nlm.nih.gov/10469325/
- Crockford D, et al. Thymosin β4: structure, function, and therapeutic potential. Ann N Y Acad Sci. 2010;1194:179–189. https://pubmed.ncbi.nlm.nih.gov/20536459/
- Bock-Marquette I, et al. Thymosin β4 activates integrin-linked kinase and promotes cardiac repair. Nature. 2004;432:466–472. https://pubmed.ncbi.nlm.nih.gov/15565145/
- Pickart L, Thaler MM. Tripeptide in human serum that prolongs survival of hepatocytes. Exp Cell Res. 1973;79(2):479–482. https://pubmed.ncbi.nlm.nih.gov/4359639/
- Pickart L. The human tripeptide GHK and tissue remodeling. J Biomater Sci Polym Ed. 2008;19(8):969–988. https://pubmed.ncbi.nlm.nih.gov/18608969/
- Alhammad RM, et al. GHK-Cu: antioxidant and regenerative properties. Oxid Med Cell Longev. 2019;2019:Article 2785203. https://pubmed.ncbi.nlm.nih.gov/31687064/
- Kang EA, et al. BPC-157 protects intestinal anastomosis healing. J Physiol Pharmacol. 2018;69(3):439–451. https://pubmed.ncbi.nlm.nih.gov/30148338/
- Xu B, et al. Thymosin β4 enhances ligament healing. Regul Pept. 2013;184:1–5. https://pubmed.ncbi.nlm.nih.gov/23523891/
- Hsieh MJ, et al. BPC-157 enhances functional recovery after sciatic nerve transection. J Orthop Res. 2017;35(10):2337–2346. https://pubmed.ncbi.nlm.nih.gov/28432863/
- Pickart L, et al. GHK-Cu and gene expression in human aging. BioMed Res Int. 2015;2015:648108. https://pubmed.ncbi.nlm.nih.gov/26078442/
HIGHEST QUALITY PEPTIDES
Our products are scientifically formulated and manufactured in cGMP-compliant facilities.
FAST DELIVERY
Enjoy fast and reliable 3–5 day shipping.
Dedicated Customer Service
Our customer service team is highly knowledgeable in peptide research and its applications. We’re available 24/7 to assist you.
Tested. Verified. Trusted.
We take a laboratory-first approach to quality. Each batch is made under controlled conditions and verified by an independent lab (HPLC/MS). We only ship batches that test ≥99% purity, and we provide a full COA, including identity, methods, and chromatograms, for your review.
See the Process for Yourself
We make our peptides in our own cGMP lab. Watch the video to see how every vial is produced, tested, and handled with care.
Science Behind Our Peptides
A clear explanation of how our peptides work, their benefits, why quality matters for best results, and what you should know.
Categories
Categories
How do I know the peptides I order are exactly what the label says?
Every vial we sell comes from a lab that follows current Good Manufacturing Practices (cGMP). That means each step of production is documented and controlled. Before a batch is released, it’s tested by independent third-party labs for purity, identity, and sterility. Certificates of analysis are available so you can see the exact test results.
Are your peptides produced in a sterile and controlled environment?
Yes. The labs we work with use ISO-certified clean rooms where air quality, equipment, and handling procedures are tightly regulated. Staff are trained to pharmaceutical-grade standards. This ensures the peptides are produced in an environment that minimizes contamination risks.
What about shipping? Do the peptides remain stable in transit?
Peptides in lyophilized (freeze-dried) form are stable at room temperature for transport. Once you receive them, refrigeration is recommended to maintain long-term integrity. We package every order securely to prevent damage and ship promptly, so your vials arrive in optimal condition.
How do I know you actually make these peptides yourselves?
We operate under strict in-house protocols that follow current Good Manufacturing Practices (cGMP). That means our team oversees the entire process from sourcing raw amino acids to the final lyophilized vial. Nothing is outsourced or repackaged. This gives us full control over purity, consistency, and sterility, and it’s why we can stand behind every single vial we ship.
What should I do with the vials once they arrive?
Store them in the refrigerator, away from direct light and heat. If you need to keep them longer, some peptides can be stored frozen. Each vial comes with clear handling instructions so you know the proper conditions for stability.
What proof do you have that your peptides are legitimate?
The strongest proof is transparency. For every peptide, we can provide certificates of analysis, manufacturing documentation, and references to the published scientific research behind it. If you ever have questions, we’ll show you the data rather than ask you to take our word for it.