Semaglutide
From CAD $32 CAD $128
Contents: Semaglutide (GLP-1 Receptor Agonist)
Form: Powder
Purity: 99.3%
TESTED FOR:
- PURITY
- STERILITY
- WEIGHT
- ENDOTOXINS(LPS)
Free Reconstitution solution automatically added to your cart with each order of vial.
This product is Made, Tested & Shipped From Canada.
Ships Today
Order by 1:00 PM EST
Free Shipping
For 2 or more vials
99%+ Purity Guaranteed
COA Verified+
Trackable Shipping
Semaglutide Peptide
Semaglutide is a synthetic glucagon-like peptide-1 (GLP-1) receptor agonist derived from human GLP-1. It has been engineered for enhanced metabolic stability and extended duration of action through structural modifications that increase resistance to enzymatic degradation and promote albumin binding. Semaglutide is of significant research interest for its potential roles in glucose metabolism, appetite regulation, and cardiometabolic health.
Overview
Semaglutide acts as a long-acting GLP-1 receptor agonist, stimulating insulin secretion and reducing glucagon release in a glucose-dependent manner. It also delays gastric emptying and influences central appetite regulation, resulting in improved metabolic control in preclinical and clinical research models.
The substitution of α-aminoisobutyric acid at position 8 protects the molecule from dipeptidyl peptidase-4 (DPP-4) degradation, while the addition of a C18 fatty diacid side chain at Lys26 allows for reversible albumin binding. These modifications collectively extend Semaglutide’s plasma half-life and bioactivity, allowing for sustained receptor engagement in metabolic studies.
Chemical Makeup
- Molecular Formula: C187H291N45O59
- Molecular Weight: 4113.6 g/mol
- Amino Acid Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (GLP-1 analog with Aib8 and C18 fatty diacid at Lys26)
- Compound Class: GLP-1 receptor agonist
- Form: Lyophilized powder
- Purity: ≥99% (per COA)
- Size: 2mg, 5mg, 10mg, 15mg, 20mg, 30mg vials available
Research and Clinical Studies
Glucose Metabolism
Semaglutide enhances glucose-dependent insulin secretion and reduces glucagon output, leading to improved glycemic control in diabetic and metabolic syndrome models.
Appetite and Weight Regulation
Preclinical and human research demonstrates Semaglutide reduces food intake and body weight through GLP-1 receptor activation in the hypothalamus, influencing satiety and reward pathways.
Cardiometabolic Function
Studies suggest that Semaglutide may lower blood pressure, improve lipid profiles, and reduce markers of oxidative stress and inflammation, contributing to cardiovascular health.
Liver and Metabolic Research
In models of nonalcoholic fatty liver disease (NAFLD) and nonalcoholic steatohepatitis (NASH), Semaglutide has shown potential to decrease hepatic steatosis and improve liver enzyme profiles.
Pharmacokinetics
Semaglutide’s albumin-binding modification extends its plasma half-life to approximately one week, providing sustained receptor activation suitable for long-term metabolic research applications.
Semaglutide peptide is available for research and laboratory purposes only. Not for human consumption.
References
- Lau J, et al. Discovery of Semaglutide, a long-acting GLP-1 analog. J Med Chem. 2015;58(18):7370–7380. https://pubmed.ncbi.nlm.nih.gov/26307822/
- Drucker DJ. Mechanisms of action and therapeutic application of GLP-1 receptor agonists. Cell Metab. 2018;27(4):740–756. https://pubmed.ncbi.nlm.nih.gov/29551581/
- Jensen L, et al. Semaglutide pharmacokinetics and metabolic effects. Diabetes Obes Metab. 2017;19(1):34–43. https://pubmed.ncbi.nlm.nih.gov/27699838/
- Wilding JPH, et al. Semaglutide and weight management in clinical research. N Engl J Med. 2021;384(11):989–1002. https://pubmed.ncbi.nlm.nih.gov/33567185/
- Davies MJ, et al. Semaglutide’s impact on glucose control and body weight. Lancet Diabetes Endocrinol. 2017;5(5):341–354. https://pubmed.ncbi.nlm.nih.gov/28237263/
- Nauck MA, et al. GLP-1 receptor agonists in metabolic disease models. Diabetologia. 2016;59(4):763–776. https://pubmed.ncbi.nlm.nih.gov/26802080/
- Holst JJ, et al. Physiology of GLP-1 and receptor pathways. Physiol Rev. 2017;97(2):1409–1439. https://pubmed.ncbi.nlm.nih.gov/28356471/
- Newsome PN, et al. Semaglutide in nonalcoholic steatohepatitis research. N Engl J Med. 2021;384(12):1113–1124. https://pubmed.ncbi.nlm.nih.gov/33761207/
- Nauck MA, Meier JJ. Pharmacology of GLP-1 receptor agonists. Diabetologia. 2019;62(10):1808–1823. https://pubmed.ncbi.nlm.nih.gov/31201557/
- Marso SP, et al. Cardiovascular outcomes with Semaglutide in metabolic studies. N Engl J Med. 2016;375(19):1834–1844. https://pubmed.ncbi.nlm.nih.gov/27633186/
HIGHEST QUALITY PEPTIDES
Our products are scientifically formulated and manufactured in cGMP-compliant facilities.
FAST DELIVERY
Enjoy fast and reliable 3–5 day shipping.
Dedicated Customer Service
Our customer service team is highly knowledgeable in peptide research and its applications. We’re available 24/7 to assist you.
Tested. Verified. Trusted.
We take a laboratory-first approach to quality. Each batch is made under controlled conditions and verified by an independent lab (HPLC/MS). We only ship batches that test ≥99% purity, and we provide a full COA, including identity, methods, and chromatograms, for your review.
See the Process for Yourself
We make our peptides in our own cGMP lab. Watch the video to see how every vial is produced, tested, and handled with care.
Science Behind Our Peptides
A clear explanation of how our peptides work, their benefits, why quality matters for best results, and what you should know.
Categories
Categories
How do I know the peptides I order are exactly what the label says?
Every vial we sell comes from a lab that follows current Good Manufacturing Practices (cGMP). That means each step of production is documented and controlled. Before a batch is released, it’s tested by independent third-party labs for purity, identity, and sterility. Certificates of analysis are available so you can see the exact test results.
Are your peptides produced in a sterile and controlled environment?
Yes. The labs we work with use ISO-certified clean rooms where air quality, equipment, and handling procedures are tightly regulated. Staff are trained to pharmaceutical-grade standards. This ensures the peptides are produced in an environment that minimizes contamination risks.
What about shipping? Do the peptides remain stable in transit?
Peptides in lyophilized (freeze-dried) form are stable at room temperature for transport. Once you receive them, refrigeration is recommended to maintain long-term integrity. We package every order securely to prevent damage and ship promptly, so your vials arrive in optimal condition.
How do I know you actually make these peptides yourselves?
We operate under strict in-house protocols that follow current Good Manufacturing Practices (cGMP). That means our team oversees the entire process from sourcing raw amino acids to the final lyophilized vial. Nothing is outsourced or repackaged. This gives us full control over purity, consistency, and sterility, and it’s why we can stand behind every single vial we ship.
What should I do with the vials once they arrive?
Store them in the refrigerator, away from direct light and heat. If you need to keep them longer, some peptides can be stored frozen. Each vial comes with clear handling instructions so you know the proper conditions for stability.
What proof do you have that your peptides are legitimate?
The strongest proof is transparency. For every peptide, we can provide certificates of analysis, manufacturing documentation, and references to the published scientific research behind it. If you ever have questions, we’ll show you the data rather than ask you to take our word for it.